You have no items in your shopping cart.
CHI3L1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Reactivity | Human, Monkey |
| Predicted Reactivity | Bovine, Canine, Goat, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1 |
| Target | CHI3L1 |
| Protein Sequence | Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL |
| Molecular Weight | 43 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CHI3L1 Rabbit Polyclonal Antibody [orb10365]
ICC, WB
Human, Mouse
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlCHI3L1 Rabbit Polyclonal Antibody [orb182759]
FC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

simian immunodeficiency virus encephalitis.

WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
CHI3L1 Rabbit Polyclonal Antibody (orb581500)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









