You have no items in your shopping cart.
CNTF Protein
SKU: orb424833
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. |
| Protein Sequence | AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Purity | Greater than 99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−HCNTF, CNTF, Ciliary Neurotrophic Factor.
Similar Products
−Human CNTF protein [orb603982]
Greater than 90% as determined by SDS-PAGE.
26.1 kDa
E.coli
1 mg, 20 μg, 100 μgHuman CNTF protein [orb603981]
Greater than 85% as determined by SDS-PAGE.
27.0 kDa
E.coli
20 μg, 100 μg, 1 mgHuman CNTF protein [orb594966]
Greater than 85% as determined by SDS-PAGE.
26.8 kDa
Baculovirus
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
CNTF Protein (orb424833)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







