Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CNTF Protein

SKU: orb424833

Description

Recombinant of CNTF protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceEscherichia Coli
Biological ActivityFully biologically active by its ability to phosphorylate STAT3 in several cells lines.
PurityGreater than 99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE.
Protein SequenceAFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Storage & Handling

StorageStability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesLyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HCNTF, CNTF, Ciliary Neurotrophic Factor.

Similar Products

  • CNTFR Antibody [orb350369]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • CNTF Antibody [orb238930]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Human CNTF protein [orb435827]

    ELISA,  FA,  WB

    >98% by SDS PAGE/HPLC

    20 μg
  • Human CNTF protein [orb594966]

    Greater than 85% as determined by SDS-PAGE.

    26.8 kDa

    Baculovirus

    1 mg, 100 μg, 20 μg
  • Human CNTF protein (Active) [orb359177]

    > 97% as determined by SDS-PAGE and HPLC.

    22.9 kDa

    E.Coli

    500 μg, 100 μg, 5 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

CNTF Protein (orb424833)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
25 μg
$ 350.00
1 mg
$ 3,620.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry