You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| CAS Number | 86280-64-0 |
| MW | 4281.74 |
| Purity | ≥95% |
| Formula | C183H307N57O61 |
| Protein Sequence | AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Rat copeptin ELISA Kit [orb410903]
Rat
62.5 pg/mL-4000 pg/mL
15.6 pg/mL
5 x 96 T, 48 T, 96 T, 10 x 96 T, 24 TRat AVP ELISA Kit [orb410987]
Rat
0.235 ng/ml-15 ng/ml.
0.05 ng/ml.
48 T, 96 T, 5 x 96 T, 10 x 96 T, 24 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Copeptin (rat) (orb2692856)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review