You have no items in your shopping cart.
coronavirus HKU1 Non-structural protein 4 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 20.0 kDa |
| Expression Region | 1-109aa |
| Protein Length | Full Length |
| Protein Sequence | MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human coronavirus HKU1 Non-structural protein 4 protein [orb704952]
Greater than 85% as determined by SDS-PAGE.
18.5 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096650]
Greater than 85% as determined by SDS-PAGE.
13.4 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096672]
Greater than 90% as determined by SDS-PAGE.
14 kDa
Yeast
1 mg, 20 μg, 100 μgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096620]
Greater than 85% as determined by SDS-PAGE.
13.6 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096678]
Greater than 90% as determined by SDS-PAGE.
14.1 kDa
Yeast
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
coronavirus HKU1 Non-structural protein 4 protein (orb704966)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



