Cart summary

You have no items in your shopping cart.

CoV-NL63 Protein

SKU: orb424856

Description

Recombinant of CoV-NL63 protein

Images & Validation

Application Notes
Viral Antigens- Sars Proteins

Key Properties

SourceEscherichia Coli
Protein SequenceGSSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDA KGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAF TKPSSIKEMQSLEHHHHHH
PurityProtein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).

Storage & Handling

StorageStability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
Form/AppearanceSterile Filtered clear solution.
Buffer/PreservativesCoronavirus NL63 protein solution is supplied in PBS and 25mM K2CO3.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

CoV-NL63 Protein (orb424856)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 380.00
0.5 mg
$ 1,010.00
1 mg
$ 1,890.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry