Cart summary

You have no items in your shopping cart.

CPT1B Rabbit Polyclonal Antibody

SKU: orb330486

Description

Rabbit polyclonal antibody to CPT1B

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPT1B
TargetCPT1B
Protein SequenceSynthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Molecular Weight88 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CPT1-M antibody, anti KIAA1670 antibody, anti M-CPT1 antibody, anti CPTI antibody, anti CPT1M antibody, anti MCPT1 antibody, anti CPTI-M antibody, anti MCCPT1 antibody

Similar Products

  • CPT1B Rabbit Polyclonal Antibody [orb308786]

    IF,  IHC,  IHC-Fr,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CPTI-M rabbit pAb Antibody [orb767484]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CPT1B Rabbit Polyclonal Antibody [orb865378]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CPT1B Antibody [orb394914]

    ELISA,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • CPT1B Antibody [orb676004]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CPT1B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

CPT1B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

CPT1B Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

CPT1B Rabbit Polyclonal Antibody

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

CPT1B Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

CPT1B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

CPT1B Rabbit Polyclonal Antibody

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.

CPT1B Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit Alexa Fluor 488, Secondary antibody Dilution: 1:200.

CPT1B Rabbit Polyclonal Antibody

Sample Type: 1: 45 ug human capan1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1B.

CPT1B Rabbit Polyclonal Antibody

WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, CPT1B is supported by BioGPS gene expression data to be expressed in HT1080.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004368

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CPT1B Rabbit Polyclonal Antibody (orb330486)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry