Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CXCL12 Rabbit Polyclonal Antibody

SKU: orb333745

Description

CXCL12 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CXCL12. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CXCL12. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CXCL12
TargetCXCL12
Protein SequenceSynthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Molecular Weight11 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C-X-C motif chemokine 12 antibody, anti CXCL12 antibody, anti CXCL-12 antibody, anti CXCL 12 antibody, anti hIRH antibody, anti hSDF-1 antibody, anti Intercrine reduced in hepatomas antibody, anti IRH antibody, anti PBSF antibody, anti SCYB12 antibody, anti SDF 1 alpha antibody, anti SDF 1 antibody, anti SDF 1 beta antibody, anti SDF 1b antibody, anti SDF-1 antibody, anti SDF-1a antibody, anti SDF-1b antibody, anti SDF1 antibody, anti SDF1a antibody, anti SDF1b antibody, anti Stromal cell derived factor 1 antibody, anti TLSF a antibody, anti TLSF antibody, anti TLSF b antibody, anti TLSF-a antibody, anti TLSF-b antibody, anti TLSFa antibody, anti TLSFb antibody, anti TPAR1 antibody

Similar Products

  • CXCL12 Rabbit Polyclonal Antibody [orb443170]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SDF1 Rabbit Polyclonal Antibody [orb11353]

    ELISA,  IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 500 μg
  • SDF1 Rabbit Polyclonal Antibody [orb251479]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Canine, Gallus, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CXCL12 Antibody [orb676418]

    ELISA,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PIM1 Antibody [orb38744]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000600

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry