Cart summary

You have no items in your shopping cart.

CXCL12 Rabbit Polyclonal Antibody

SKU: orb333745

Description

Rabbit polyclonal antibody to SDF1

Research Area

Cell Biology, Immunology & Inflammation, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CXCL12
TargetCXCL12
Protein SequenceSynthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Molecular Weight11 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C-X-C motif chemokine 12 antibody, anti CXCL12 antibody, anti CXCL-12 antibody, anti CXCL 12 antibody, anti hIRH antibody, anti hSDF-1 antibody, anti Intercrine reduced in hepatomas antibody, anti IRH antibody, anti PBSF antibody, anti SCYB12 antibody, anti SDF 1 alpha antibody, anti SDF 1 antibody, anti SDF 1 beta antibody, anti SDF 1b antibody, anti SDF-1 antibody, anti SDF-1a antibody, anti SDF-1b antibody, anti SDF1 antibody, anti SDF1a antibody, anti SDF1b antibody, anti Stromal cell derived factor 1 antibody, anti TLSF a antibody, anti TLSF antibody, anti TLSF b antibody, anti TLSF-a antibody, anti TLSF-b antibody, anti TLSFa antibody, anti TLSFb antibody, anti TPAR1 antibody

Similar Products

  • CXCL12 Rabbit Polyclonal Antibody [orb443170]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CXCL12 Antibody [orb676418]

    ELISA,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CXCL12 Rabbit Polyclonal Antibody [orb1319]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Gallus, Guinea pig, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CXCL12 Antibody [orb675875]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • SDF-1 rabbit pAb Antibody [orb766289]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CXCL12 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

CXCL12 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

CXCL12 Rabbit Polyclonal Antibody

WB Suggested Anti-CXCL12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000600

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CXCL12 Rabbit Polyclonal Antibody (orb333745)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry