You have no items in your shopping cart.
CXCR4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | FC, IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Equine, Porcine, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR4 |
| Target | CXCR4 |
| Protein Sequence | Synthetic peptide located within the following region: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL |
| Molecular Weight | 40 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CXCR4 Rabbit Polyclonal Antibody [orb10305]
IF, IHC-Fr, IHC-P, WB
Bovine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μlFusin (phospho Ser339) rabbit pAb Antibody [orb770434]
ELISA, IF, IHC, WB
Human, Monkey, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlFusin rabbit pAb Antibody [orb765255]
ELISA, IF, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlLAP3 Rabbit Polyclonal Antibody [orb583305]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary dilution: 1:100, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary dilution: 1:500.

CXCR4 antibody - N-terminal region (orb573686) validated by WB using 721_B cell Lysate at 0.2-1 ug/ml.

CXCR4 antibody - N-terminal region (orb573686) validated by WB using human microvascular endothelial cells (25 ug) at 1:1000.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with HMEC-1 and A549 cells tissue.

Sample Type: HMEC-1 and A549 cells. Cell Lines: 3201 are feline B lymphocyte cell line positive for CXCR4. The PBMCs used here are feline and should be negative or very low for CXCR4. HSB2 are a human T cell lymphoblastoid cell line positive for CXCR4. Jurkat are an immortalized human T lymphocytes that are positive for CXCR4.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-CXCR4 Antibody, Positive Control: Lane 1: 20 ug mouse brain extract, Lane 2: 20 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-CXCR4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.
Documents Download
Request a Document
Protocol Information
CXCR4 Rabbit Polyclonal Antibody (orb573686)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



















