You have no items in your shopping cart.
CYP11B1 Rabbit Polyclonal Antibody
Description
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Monkey |
| Predicted Reactivity | Porcine, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1 |
| Target | CYP11B1 |
| Protein Sequence | Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
| Molecular Weight | 58 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CYP11B1 Rabbit Polyclonal Antibody [orb783391]
WB
Human, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlCYP11B1 Rabbit Polyclonal Antibody [orb500751]
WB
Bovine, Canine, Equine, Porcine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlCYP11B1/C11B2/CYP11B2 Rabbit Polyclonal Antibody [orb654417]
ELISA, FC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:10000, Film Exposed for: 5 minutes.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.
Documents Download
Request a Document
Protocol Information
CYP11B1 Rabbit Polyclonal Antibody (orb584585)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








