You have no items in your shopping cart.
CYP21A2 Rabbit Polyclonal Antibody
Description
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Monkey |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Porcine, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2 |
| Target | CYP21A2 |
| Protein Sequence | Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
| Molecular Weight | 56kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CYP21A2 Rabbit Polyclonal Antibody [orb13362]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Human, Mouse, Porcine
Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlCYP21A2 rabbit pAb Antibody [orb767829]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus, Gene Name: CYP21A2.

Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus, Gene Name: CYP21A2.

WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
Documents Download
Request a Document
Protocol Information
CYP21A2 Rabbit Polyclonal Antibody (orb584587)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



