You have no items in your shopping cart.
EEF2KMT Rabbit Polyclonal Antibody
SKU: orb587395
Description
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human EEF2KMT |
| Target | EEF2KMT |
| Protein Sequence | Synthetic peptide located within the following region: CPEAIMSLVGVLRRLAACREHQRAPEVYVAFTVRNPETCQLFTTELGRAG |
| Molecular Weight | 29kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−EFM3, SB153, FAM86A, eEF2-KMT
Similar Products
−EEF2KMT Rabbit Polyclonal Antibody [orb587394]
WB
Bovine, Canine, Equine, Guinea pig, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlEEF2KMT Rabbit Polyclonal Antibody (HRP) [orb2086472]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rat
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: THP-1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001275958.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
EEF2KMT Rabbit Polyclonal Antibody (orb587395)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
