You have no items in your shopping cart.
C15orf24 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C15orf24 |
| Target | EMC7 |
| Protein Sequence | Synthetic peptide located within the following region: VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD |
| Molecular Weight | 26kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−C15orf24 Rabbit Polyclonal Antibody (HRP) [orb2113085]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlC15orf24 Rabbit Polyclonal Antibody (FITC) [orb2113086]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μlC15orf24 Rabbit Polyclonal Antibody (Biotin) [orb2113087]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WB Suggested Anti-C15orf24 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.
Documents Download
Request a Document
C15orf24 Rabbit Polyclonal Antibody (orb325478)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
