Cart summary

You have no items in your shopping cart.

Equine CCL3 protein

SKU: orb1216352

Description

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909).

Images & Validation

Key Properties

SourceYeast
Biological OriginEquine
TargetCCL3
Molecular Weight7.8 kDa
Protein Length70.0
Protein SequenceVPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MIP-1 alpha

Similar Products

  • Equine CCL3 ELISA Kit [orb1216621]

    Equine

    1 set (2 x capture antibody), 1 set (1 x capture antibody)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Equine CCL3 protein (orb1216352)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry