Cart summary

You have no items in your shopping cart.

Exendin-4 (3-39) amide

SKU: orb1140522

Description

Glucagon like peptide 1 (GLP-1) receptor antagonist; Peptides.

Research Area

Metabolism Research

Images & Validation

Key Properties

Molecular Weight3992.4 Da
Protein SequenceH-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Purity> 95% by HPLC

Storage & Handling

StorageStore desiccated, frozen and in the dark
Form/AppearanceFreeze dried solid
DisclaimerFor research use only

Alternative Names

196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Exendin-4 (3-39) amideGH008 ., GLP-1, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, antagonist, glucagon-like peptide 1
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Exendin-4 (3-39) amide (orb1140522)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry