You have no items in your shopping cart.
Exendin-4 (3-39) amide
SKU: orb1140522
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Molecular Weight | 3992.4 Da |
|---|---|
| Protein Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store desiccated, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Exendin-4 (3-39) amideGH008 ., GLP-1, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, antagonist, glucagon-like peptide 1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Exendin-4 (3-39) amide (orb1140522)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review