Cart summary

You have no items in your shopping cart.

Feline M-CSF protein

SKU: orb1215807

Description

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467).

Images & Validation

Key Properties

SourceYeast
Biological OriginFeline
TargetM-CSF
Molecular Weight18.4 kDa
Protein Length158.0
Protein SequenceEEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Feline M-CSF protein (orb1215807)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry