You have no items in your shopping cart.
FGF14 Peptide - N-terminal region
SKU: orb2001148
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Application Notes |
Key Properties
−| Molecular Weight | 27 kDa |
|---|---|
| Protein Sequence | Synthetic peptide located within the following region: AIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRI |
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FHF4, FHF-4, SCA27, FGF-14

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
RefSeq (Protein):NP_004106.1
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_004106.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
FGF14 Peptide - N-terminal region (orb2001148)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review