You have no items in your shopping cart.
FOXM1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FOXM1 |
| Target | FOXM1 |
| Protein Sequence | Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ |
| Molecular Weight | 84kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FOXM1 Rabbit Polyclonal Antibody [orb1993153]
ELISA, FC, ICC, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgFOXM1 rabbit pAb Antibody [orb771925]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlFOXM1 Rabbit Polyclonal Antibody [orb577161]
WB
Canine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).

Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).

Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate, Lane 3: 25 ug Huh-7 cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: FOXM1.

WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
FOXM1 Rabbit Polyclonal Antibody (orb592704)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








