You have no items in your shopping cart.
GABRP Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP |
| Target | GABRP |
| Protein Sequence | Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
| Molecular Weight | 51 kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−GABA A receptor pi Rabbit Polyclonal Antibody [orb157013]
WB
Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlGabrp Rabbit Polyclonal Antibody [orb324595]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlGabrp Rabbit Polyclonal Antibody (Biotin) [orb2133767]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlGabrp Rabbit Polyclonal Antibody (HRP) [orb2133768]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Human esophagus (ES), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

WB Suggested Anti-GABRP Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2/Jurkat.
Documents Download
Request a Document
GABRP Rabbit Polyclonal Antibody (orb327620)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













