You have no items in your shopping cart.
GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
SKU: orb2694491
Description
Images & Validation
−
Key Properties
−| Target | GCCR |
|---|---|
| Molecular Weight | 4169.57 |
| Protein Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
GCCR
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) (orb2694491)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review