You have no items in your shopping cart.
GLP-1 (9-36) amide
SKU: orb1147100
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Molecular Weight | 3089.4 Da |
|---|---|
| Protein Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, frozen and desiccated |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−161748-29-4, EGTFTSDVSSYLEGQAAKEFIAWLVKGRGH040, GLP-1 (9-36) amide, GLP-1 receptor, Glucagon-like peptide-1 (9-36) amide, Glucagon-like peptide-1-(9-36) amide, H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, glucoregulatory, insulinotropic , metabolite
Similar Products
−- Item 1 of 1
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) [orb2694527]
≥95%
3089.48
5 mg, 10 mg
GLP-1 (9-36) amide [orb1679131]
97.00%
161748-29-4
3089.41
C140H214N36O43
50 mg, 100 mg, 25 mg, 1 mg, 5 mg, 10 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
GLP-1 (9-36) amide (orb1147100)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days