You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1 |
| Target | GLUD1 |
| Protein Sequence | Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
| Molecular Weight | 61 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GLUD1/2 Rabbit Polyclonal Antibody [orb1152344]
ELISA, FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgGLUD1 Rabbit Polyclonal Antibody [orb579550]
IHC, WB
Bovine, Canine, Equine, Mouse, Porcine, Sheep, Yeast, Zebrafish
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μlGLUD1 Antibody (C-term) [orb1938009]
IHC-P, WB
Porcine, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μlGLUD1 Rabbit Polyclonal Antibody [orb341324]
IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

GLUD1 antibody - N-terminal region (orb579551) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Immunohistochemistry with cortex/kidney tissue.

Immunohistochemistry with pFa fixed human brain tissue.

Immunohistochemistry with pFA fixed human pancreas tissue tissue.

lanes 5: rat kidney cordex, lanes 6: rat kidney proximal tubules prepped from cortex, lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate, lanes 8: rat brain supernatant.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
Documents Download
Request a Document
Protocol Information
GLUD1 Rabbit Polyclonal Antibody (orb579551)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


























