Cart summary

You have no items in your shopping cart.

GOLGB1 Rabbit Polyclonal Antibody

SKU: orb325275

Description

Rabbit polyclonal antibody to GOLGB1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GOLGB1
TargetGOLGB1
Protein SequenceSynthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Molecular Weight376 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti GCP antibody, anti GCP372 antibody, anti GIANTIN antibody, anti GOLIM1 antibody

Similar Products

  • Giantin/GOLGB1 Rabbit Polyclonal Antibody [orb865698]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Giantin Rabbit Polyclonal Antibody [orb157139]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine, Equine, Hamster, Monkey, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Giantin Rabbit Polyclonal Antibody (BF488) [orb1586156]

    FC,  IF

    Canine, Equine, Hamster, Monkey, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    BF488

    100 μl
  • GOLGB1 Rabbit Polyclonal Antibody [orb395080]

    ELISA,  IF

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GOLGB1 Rabbit Polyclonal Antibody (HRP) [orb2116739]

    IHC,  WB

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GOLGB1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 4 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with orb325275 at 5 ug/mL.

GOLGB1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

GOLGB1 Rabbit Polyclonal Antibody

WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, GOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004478

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GOLGB1 Rabbit Polyclonal Antibody (orb325275)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry