Cart summary

You have no items in your shopping cart.

GSR Rabbit Polyclonal Antibody

SKU: orb582295

Description

Rabbit polyclonal antibody to GSR

Research Area

Cardiovascular Research, Epigenetics & Chromatin, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Zebrafish
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GSR
TargetGSR
Protein SequenceSynthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GR, GSRD, HEL-75, HEL-S-122m

Similar Products

  • Glutathione Reductase/GSR Rabbit Polyclonal Antibody [orb413058]

    ELISA,  FC,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GSR Antibody (C-term) [orb30023]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • Glutathione Reductase Rabbit Polyclonal Antibody [orb10757]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GSR Rabbit Polyclonal Antibody [orb627537]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Glutathione Reductase Rabbit Polyclonal Antibody [orb544558]

    IF,  IHC-Fr,  IHC-P

    Mouse

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GSR Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

GSR Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in HepG2.

GSR Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

GSR Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

GSR Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

GSR Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in 721_B.

GSR Rabbit Polyclonal Antibody

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse skeletal muscle lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GSR.

GSR Rabbit Polyclonal Antibody

Rabbit Anti-GSR Antibody, Catalog Number: orb582295, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GSR Rabbit Polyclonal Antibody

WB Suggested Anti-GSR Antibody, Positive Control: Lane 1: 10 ug untreated zebrafish head lysate, Lane 2: 10 ug 3hr H2O2 treated zebrafish head lysate, Lane 3: 10 ug 6hr H2O2 treated zebrafish head lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:10000.

GSR Rabbit Polyclonal Antibody

WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000628

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GSR Rabbit Polyclonal Antibody (orb582295)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry