Cart summary

You have no items in your shopping cart.

HGF Rabbit Polyclonal Antibody

SKU: orb579132

Description

Rabbit polyclonal antibody to IL6

Research Area

Cell Biology, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HGF
TargetHGF
Protein SequenceSynthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
Molecular Weight83 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SF, HGFB, HPTA, F-TCF, DFNB39

Similar Products

  • Met (phospho Tyr1234) rabbit pAb Antibody [orb764235]

    ELISA,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Met (phospho Tyr1349) rabbit pAb Antibody [orb764236]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Met rabbit pAb Antibody [orb765658]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • Met (phospho Tyr1356) rabbit pAb Antibody [orb769108]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Met (phospho Tyr1003) rabbit pAb Antibody [orb769109]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

HGF Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein is processed to yield 51 kDa alpha chain.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: human liver cancer, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 3 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 721_B Cell lysates, Antibody Dilution: 1.0 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: Human HepG2 cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

HGF Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

HGF Rabbit Polyclonal Antibody

Immunohistochemistry with Human Adrenal Gland lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HGF antibody (orb579132).

HGF Rabbit Polyclonal Antibody

WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that HGF is expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HGF Rabbit Polyclonal Antibody (orb579132)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry