You have no items in your shopping cart.
HNRNPDL Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNRPDL |
| Target | HNRNPDL |
| Protein Sequence | Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL |
| Molecular Weight | 40kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−HnRNP DL Rabbit Polyclonal Antibody [orb184072]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Gallus, Human, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlHNRNPDL Rabbit Polyclonal Antibody [orb577675]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Rabbit Anti-HNRNPDL Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HNRPDL Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HNRPDL Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HNRPDL Antibody Titration: 1.0 ug/ml, Positive Control: Daudi cell lysate. HNRNPDL is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.
Documents Download
Request a Document
Protocol Information
HNRNPDL Rabbit Polyclonal Antibody (orb577674)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




