You have no items in your shopping cart.
Horse IL1RA protein (Active)
SKU: orb359025
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Equus caballus (Horse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 3.0 μg/ml, corresponding to a specific activity of > 333 IU/mg in the presence of 50 pg/ml rHuIL-1α. |
| Tag | Tag-Free |
| Molecular Weight | 17.4 kDa |
| Expression Region | 26-177aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−DIRA protein, ICIL 1RA protein, ICIL-1RA protein, ICIL1RA protein, IL-1ra protein, IL-1ra3 protein, IL-1RN protein, IL1 inhibitor protein, IL1F3 protein, IL1RA protein, IL1RA_HUMAN protein, IL1RN (IL1F3) protein, IL1 RN protein, IL1RN protein, IL1 RA protein, Interleukin 1 receptor antagonist protein, Interleukin-1 receptor antagonist protein protein, Intracellular IL 1 receptor antagonist type II protein, Intracellular interleukin 1 receptor antagonist (icIL 1ra) protein, IRAP protein, MGC10430 protein, MVCD4 protein, Type II interleukin 1 receptor antagonist protein

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Horse IL1RA protein (Active)
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Horse IL1RA protein (Active) (orb359025)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review