You have no items in your shopping cart.
HPV11 E6 Antibody
SKU: orb153333
Description
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000 |
| Reactivity | Virus |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 65 aa to N-terminal of HPV11 E6 produced in E. coli. Antigen Sequence: MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACA |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | Please inquire |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−HPV-16 E6 + HPV-18 E6 Antibody Cocktail [orb640128]
IHC-P
Virus
Mouse
Monoclonal
Unconjugated
100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Western blot analysis of HEK293 cell line lysate and MBP-E6 (N-term) recombinant protein using HPV11 E6 antibody.
Documents Download
Datasheet
Product Information
Request a Document
HPV11 E6 Antibody (orb153333)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
