Human CD69 Protein

SKU: orb1476837

Active

Description

This Human CD69 Protein spans the amino acid sequence from region 62-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

−

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody, the EC50 is 23.17-26.04 ng/mL.
Tag	N-terminal 6xHis-tagged
Molecular Weight	18.0 kDa
Expression Region	62-199aa
Protein Length	Partial
Protein Sequence	GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Purity	Greater than 85% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Disclaimer	For research use only

Alternative Names

−

(Activation inducer molecule)(AIM)(BL-AC/P26)(C-type lectin domain family 2 member C)(EA1)(Early T-cell activation antigen p60)(GP32/28)(Leukocyte surface antigen Leu-23)(MLR-3)(CD antigen CD69)