You have no items in your shopping cart.
Human CSF1 protein (Active)
SKU: orb359033
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 6 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 18.4 kDa |
| Expression Region | 33-190aa |
| Protein Length | Partial of Isoform 3 |
| Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−CSF-1, MCSF, Lanimostim, ,
Similar Products
−Recombinant human M-CSF protein (Active, HEK293) [orb1817190]
>95% as determined by SDS-PAGE
35-40 kDa
10 μg, 50 μgRecombinant human M-CSF protein (Active, E.coli) [orb3124189]
≥ 95% as determined by SDS-PAGE.
18.4 kDa
500 μg, 50 μg, 10 μgRecombinant Human Macrophage colony-stimulating factor 1 protein(CSF1) (Active) [orb1650775]
>95% as determined by SDS-PAGE and HPLC.
36.8 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CSF1 protein (Active) (orb359033)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
