Cart summary

You have no items in your shopping cart.

Human DHH protein (Active)

SKU: orb359261
FeaturedFeatured Product

Description

This Human DHH protein (Active) spans the amino acid sequence from region 24-198aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml.
TagTag-Free
Molecular Weight19.9 kDa
Expression Region24-198aa
Protein LengthPartial
Protein SequenceII+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Purity> 96% as determined by SDS-PAGE and HPLC.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl
DisclaimerFor research use only

Alternative Names

DHH,

Similar Products

  • RecombinantShh,Mouse(CHO-expressed) [orb1494667]

    > 95% as analyzed by SDS-PAGE and HPLC.

    20 kDa, observed by non-reducing SDS-PAGE.

    CHO

    10 μg, 50 μg, 1 mg
  • RecombinantIHH,Human [orb1494835]

    > 95% as analyzed by SDS-PAGE.

    20 kDa, observed by reducing SDS-PAGE.

    Escherichia coli.

    10 μg, 50 μg, 1 mg
  • RecombinantDHH,Human [orb1494898]

    > 95% by SDS-PAGE and HPLC analyses.

    ~20 kDa, observed by reducing SDS-PAGE.

    Escherichia coli.

    10 μg, 50 μg, 1 mg
  • Recombinant Human Sonic HedgeHog (Shh) [orb1494940]

    >98% by SDS-PAGE and HPLC analyses.

    Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.

    Escherichia coli

    1 mg, 5 μg, 25 μg
  • Recombinant Human Desert hedgehog protein(DHH) (Active) [orb1650733]

    >96% as determined by SDS-PAGE and HPLC.

    19.9 kDa

    100 μg, 500 μg, 1 mg, 5 μg, 25 μg, 250 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Human DHH protein (Active)

SDS-PAGE analysis of Human DHH protein (Active)

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human DHH protein (Active) (orb359261)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 170.00
100 μg
$ 1,110.00
500 μg
$ 2,460.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry