Human EBI3 Protein

SKU: orb425206

This product can be custom made

Description

Recombinant of human EBI3 protein

Images & Validation

−

Application Notes	Cytokines And Growth Factors

Key Properties

−

Source	Escherichia Coli
Biological Activity	Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Purity	Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Protein Sequence	RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Storage & Handling

−

Storage	Stability: Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles
Form/Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Buffer/Preservatives	EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols