You have no items in your shopping cart.
Human EGF protein
SKU: orb594725
Featured
Active
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 60-450 pg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 6.2 kDa |
| Expression Region | 971-1023aa |
| Protein Length | Partial |
| Protein Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone
Similar Products
−- Item 1 of 3
Anti-EGFR [Matuzumab] [orb348869]
Blocking, ELISA, FC, IF, WB
Human
Human
Monoclonal
Unconjugated
0.2 mg - Item 1 of 1
Human Tyrosine Kinase with Immunoglobulin Like and EGF Like Domains Protein 1 (Tie1) ELISA Kit [orb775052]
Human
1.57-100 ng/mL
0.63 ng/mL
96 T, 48 T - Item 1 of 1
Human TEK Tyrosine Kinase, Endothelial (Tie2) ELISA Kit [orb775053]
Human
0.94-60 ng/mL
0.37 ng/mL
96 T, 48 T - Item 1 of 1
- Item 1 of 1
![Anti-EGFR [Matuzumab]](/images/pub/media/catalog/product/NewWebsite/35/orb348869_1.png)
![Anti-EGFR [Matuzumab]](/images/pub/media/catalog/product/NewWebsite/35/orb348869_2.png)
![Anti-EGFR [Matuzumab]](/images/pub/media/catalog/product/NewWebsite/35/orb348869_3.png)
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human EGF protein (orb594725)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks