You have no items in your shopping cart.
Human FCGR3A Protein
SKU: orb1477110
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Molecular Weight | 50.7 kDa |
| Expression Region | 49-184aa |
| Protein Length | Partial |
| Protein Sequence | GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−(IgG Fc receptor III-A)(CD16-II)(CD16a antigen)(Fc-gamma RIII-alpha)(Fc-gamma RIII)(Fc-gamma RIIIa)(FcRIII)(FcRIIIa)(FcgammaRIIIA)(FcR-10)(IgG Fc receptor III-2)(CD antigen CD16a)
Similar Products
−- Item 1 of 1
Human Fc Fragment of IgG Low Affinity Ⅲb Receptor (FcγR3B) ELISA Kit [orb1948681]
Human
0.32-20ng/mL
0.19 ng/mL
48 T, 96 T - Item 1 of 4
Human FCGR3A Protein (F176V), His Tag [orb689417]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 22.3 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μg - Item 1 of 3
- Item 1 of 3
- Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human FCGR3A Protein (orb1477110)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days