You have no items in your shopping cart.
Human FGF 23 Protein (His Tag)
SKU: orb80323
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels. |
| Protein Sequence | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH |
| Purity | Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered white lyophilized powder. |
| Buffer/Preservatives | The protein (0.5mg/ml) was lyophilized from 25mM Tris pH 7.5 and 0.6M NaCl solution. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
Similar Products
−Recombinant Human FGF23 Protein, N-His [orb2966345]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
27.63 kDa
1 mg, 50 μg, 100 μgRecombinant Human FGF23 Protein, N-His [orb2967352]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
13.9 kDa
1 mg, 50 μg, 100 μgRecombinant Human FGF23 Protein, N-His [orb2963455]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
8.75 kDa
1 mg, 50 μg, 100 μgRecombinant Human FGF23 Protein, N-His [orb2832582]
>90% as determined by SDS-PAGE.
8.75 kDa
50 μg, 100 μg, 20 μgRecombinant Human FGF23 Protein, N-His [orb2834890]
>90% as determined by SDS-PAGE.
13.92 kDa
20 μg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human FGF 23 Protein (His Tag) (orb80323)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days