You have no items in your shopping cart.
Human FGF1 protein
SKU: orb419317
Featured
Active
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 x 10 ^ 6 IU/mg in the presence of 10 μg/ml of heparin. |
| Tag | Tag-Free |
| Molecular Weight | 17.5 kDa |
| Expression Region | 1-155aa |
| Protein Length | Full Length |
| Protein Sequence | AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose |
| Disclaimer | For research use only |
Alternative Names
−FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1
Similar Products
−- Item 1 of 4
- Item 1 of 1
Human FGF1 protein [orb604089]
Greater than 85% as determined by SDS-PAGE.
17.8 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
Human FGF1 protein [orb244204]
Greater than 90% as determined by SDS-PAGE.
31.8 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
FGF1 Antibody [orb411625]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 50 μl, 100 μl, 200 μl - Item 1 of 1
Human FGFa (154AA) Protein [orb1471724]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
17.3 KDa
Mammalian
50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human FGF1 protein (orb419317)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks