Human FGF4 protein (Active)

SKU: orb359152

Featured

Active

Description

This Human FGF4 protein (Active) spans the amino acid sequence from region 25-206aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 1

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.Coli
Biological Origin	Homo sapiens (Human)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGFreceptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 x 10 ^ 6 IU/mg.
Tag	Tag-Free
Molecular Weight	19.8 kDa
Expression Region	25-206aa
Protein Length	Partial
Protein Sequence	GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Purity	> 96% as determined by SDSPAGE and HPLC.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 300 mM NaCl
Disclaimer	For research use only

Alternative Names

−

FGF-4, HST, HST-1, HSTF-1, Heparin-binding growth factor 4

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human FGF4 protein (Active)

Quick Database Links

UniProt

P08620

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols