You have no items in your shopping cart.
Human IHH protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 19.8 kDa |
| Expression Region | 29-202aa |
| Protein Length | Partial |
| Protein Sequence | II+GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1 × PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantShh,Mouse(CHO-expressed) [orb1494667]
> 95% as analyzed by SDS-PAGE and HPLC.
20 kDa, observed by non-reducing SDS-PAGE.
CHO
10 μg, 50 μg, 1 mgRecombinantIHH,Human [orb1494835]
> 95% as analyzed by SDS-PAGE.
20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinant Human Sonic HedgeHog (Shh) [orb1494940]
>98% by SDS-PAGE and HPLC analyses.
Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.
Escherichia coli
1 mg, 5 μg, 25 μgRecombinant Human Indian hedgehog protein(IHH) (Active) [orb1650679]
>96% as determined by SDS-PAGE and HPLC.
19.8 kDa
100 μg, 500 μg, 1 mg, 5 μg, 25 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human IHH protein (Active)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IHH protein (Active) (orb359262)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review