Cart summary

You have no items in your shopping cart.

Human IL12A protein

SKU: orb419321
ActiveBiologically Active

Description

This Human IL12A protein spans the amino acid sequence from region 23-219aa&23-328aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Tag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial

Key Properties

SourceBaculovirus
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
TagTag-Free
Molecular Weight57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
Expression Region23-219aa&23-328aa
Protein LengthHeterodimer
Protein Sequencep35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Purity> 95% as determined by SDS-PAGE and HPLC.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1

Similar Products

  • IL12A Antibody [orb401620]

    ELISA,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Human Active Protein [orb1476717]

    Greater than 95% as determined by SDS-PAGE.

    39.7 kDa & 27.2 kDa

    Mammalian cell

    1 mg, 100 μg, 20 μg
  • Recombinant human IL-12 protein (Active, HEK293) [orb1817198]

    >95% as determined by SDS-PAGE

    60 kDa

    500 μg, 10 μg, 50 μg
  • Human IL-35 (Interleukin 35) ELISA Kit [orb2648029]

    Human

    15.625-1000pg/ml

    9.375pg/ml

    48 T, 96 T
  • Human IL-12 Protein [orb1471767]

    Unconjugated

    Greater than 95% as determined by reducing SDS-PAGE.

    22.5and34.7 KDa

    Mammalian

    10 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Human IL12A protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human IL12A protein (orb419321)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 380.00
100 μg
$ 2,050.00
500 μg
$ 4,560.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry