You have no items in your shopping cart.
Human IL15 protein (Active)
SKU: orb358961
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 12.9 kDa |
| Expression Region | 49-162aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-15,
Similar Products
−Recombinant human IL-15 protein (Active, HEK293) [orb1817193]
>95% as determined by SDS-PAGE
14-15 kDa
10 μg, 50 μgRecombinant human IL-15(hFc Tag) protein (Active, CHO) [orb3124192]
≥ 95% as determined by SDS-PAGE.
38.7 kDa
500 μg, 50 μg, 10 μgRecombinant human IL-15 protein (Active, CHO) [orb3124193]
≥ 95% as determined by SDS-PAGE.
12.7 kDa
500 μg, 50 μg, 10 μgRecombinant Human Interleukin-15 protein(IL15) (Active) [orb1650669]
>97% as determined by SDS-PAGE and HPLC.
12.9 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL15 protein (Active) (orb358961)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review