You have no items in your shopping cart.
Human IL15RA protein
SKU: orb594821
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is 5-20 ng/ml. |
| Tag | C-terminal Fc-tagged |
| Molecular Weight | 46.9 kDa |
| Expression Region | 31-96aa&49-162aa(N120D) |
| Protein Length | Heterodimer |
| Protein Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS,5% Trehalose,ph7.4 |
| Disclaimer | For research use only |
Alternative Names
−IL15RA Protein.
Similar Products
−- Item 1 of 3
Human IL15RA protein [orb604889]
Greater than 85% as determined by SDS-PAGE.
23.4 kDa
E.coli
20 μg, 1 mg, 100 μg 
Human IL-15RA&IL-15 [orb3002349]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 34.4&12.8 KDa. Observed: 37&17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-15RA&IL-15 [orb3002427]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.9 KDa. Observed: 50-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Human IL15RA Protein, hFc Tag [orb1173911]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 1
Human IL15RA protein [orb594809]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL15RA protein (orb594821)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks