You have no items in your shopping cart.
Human IL15RA protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is 5-20 ng/ml. |
| Tag | C-terminal Fc-tagged |
| Molecular Weight | 46.9 kDa |
| Expression Region | 31-96aa&49-162aa(N120D) |
| Protein Length | Heterodimer |
| Protein Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS,5% Trehalose,ph7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IL15RA protein [orb604889]
Greater than 85% as determined by SDS-PAGE.
23.4 kDa
E.coli
20 μg, 1 mg, 100 μgHuman IL-15RA&IL-15 [orb3002349]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 34.4&12.8 KDa. Observed: 37&17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-15RA&IL-15 [orb3002427]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.9 KDa. Observed: 50-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL15RA protein [orb594809]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μgHuman IL15RA Protein, hFc Tag [orb1173911]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Documents Download
Request a Document
Protocol Information
Human IL15RA protein (orb594821)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




