You have no items in your shopping cart.
Human IL36G protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 17 kDa |
| Expression Region | 18-169aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Interleukin 1 Family, Member 9 (IL1F9) ELISA Kit [orb779986]
Human
15.63-1000 pg/mL
6 pg/mL
96 T, 48 THuman IL-36g [orb2994336]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17 KDa. Observed: 14-16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL36G protein (Active) [orb358994]
> 95% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman IL36G protein (Active) [orb358995]
> 95% as determined by SDS-PAGE and HPLC.
17.0 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman IL36G protein [orb54523]
Greater than 90% as determined by SDS-PAGE.
45.7 kDa
E.coli
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IL36G protein (orb594810)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





