You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 30-212aa |
| Protein Length | Full Length of Mature Protein |
| MW | 28.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]
Greater than 95% as determined by SDS-PAGE
22.8 kDa
Yeast
1 mg, 100 μg, 20 μgHuman CCAAT/Enhancer Binding Protein Beta (C/EBPβ) ELISA Kit [orb1949549]
Human
0.16-10ng/mL
0.1 ng/mL
48 T, 96 THuman CCAAT/Enhancer Binding Protein Beta (CEBPb) ELISA Kit [orb775897]
Human
0.16-10 ng/mL
0.061 ng/mL
96 T, 48 TRecombinant Human IL-6 Protein [orb2995250]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 20.9 KDa. Observed: 20 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IL6 protein (orb604194)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




