You have no items in your shopping cart.
Human IL8 protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 8.9 kDa |
| Expression Region | 23-99aa |
| Protein Length | Partial |
| Protein Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IL8 protein (Active) [orb359142]
> 97% as determined by SDS-PAGE and HPLC.
8.4 kDa
E.Coli
100 μg, 500 μg, 5 μgRecombinantIL-8/CXCL8(8-79aa),Human [orb1494812]
> 95% as analyzed by SDS-PAGE and HPLC.
8.4 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinantIL-8(77aa)/CXCL8,Human [orb1494813]
> 95% as analyzed by SDS-PAGE.
8.9 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
5 μg, 25 μgRecombinant Human Interleukin-8 (CXCL8), partial (Active) [orb2985848]
Greater than 95% as determined by SDS-PAGE.
10.4 kDa
Yeast
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IL8 protein (Active) (orb359143)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
