You have no items in your shopping cart.
Human interleukin 1β
SKU: orb1729593
Description
Images & Validation
−
| Tested Applications | SDS-PAGE |
|---|---|
| Application Notes |
Key Properties
−| Source | E.coli |
|---|---|
| Species/Host | E. coli |
| Expression System | Intercellular |
| Biological Origin | Recombinant protein expressed as His tage protein in E.coli |
| Reactivity | Human, Mouse |
| Tag | Histidine |
| Molecular Weight | ~17 kDa |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Purity | ≥98% |
| Endotoxins | Not tested |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | After reconstitution, store at -20°C; Avoid repeated freeze thaw |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | No preservative |
| Concentration | 1mg/mL |
| Hazard Information | For Research use only |
| Disclaimer | For research use only |
Alternative Names
−IL1B, IL1F2
Similar Products
−Human Interleukin 1 Beta (IL-1β) High Sensitivity ELISA Kit [orb1945920]
Human
0.16-10pg/mL
0.09 pg/mL
96 T, 48 THuman Interleukin 1 Beta (IL-1β) Microsample Fast ELISA Kit [orb1806721]
Human
7.82-500pg/mL
4.69 pg/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
SDS-PAGE
Sodium Dodecyl Sulphate PolyAcrylamide Gel Electrophoresis
Human interleukin 1β (orb1729593)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



