You have no items in your shopping cart.
Human LTA protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B , the EC50 is 1.632-2.699 ng/ml. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 20.8 kDa |
| Expression Region | 35-205aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human Leukotriene A4 Hydrolase (LTA4H) ELISA Kit [orb1948952]
Human
0.32-20ng/mL
0.19 ng/mL
96 T, 48 THuman LTA protein [orb594848]
Greater than 95% as determined by SDS-PAGE.
18.8 kDa
E.coli
500 μg, 10 μg, 50 μg, 1 mgLTA4H Antibody [orb521137]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human LTA protein (orb705222)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





