You have no items in your shopping cart.
Human NGAL protein (Active)
SKU: orb359266
Featured
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 20.5 kDa |
| Expression Region | 21-198aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.05 % Tween-20 |
| Disclaimer | For research use only |
Alternative Names
−Lcn 2 protein, Lcn-2 protein, Lcn2 protein, Lipocalin-2 protein, Lipocalin 2 protein, Migration stimulating factor inhibitor protein, MSFI protein, Neutrophil gelatinase associated lipocalin protein, Neutrophil gelatinase associated lipocalin precursor protein, NGAL protein, Oncogene 24p3 protein, Oncogenic lipocalin 24p3 protein, Siderocalin protein, siderocalin LCN2 protein, SV40 induced 24P3 protein protein, Uterocalin protein, 25 kDa alpha 2 microglobulin related subunit of MMP9 protein, Alpha 2 microglobulin related protein protein, HNL protein
Similar Products
−Recombinant Human Neutrophil gelatinase-associated lipocalin protein(LCN2) (Active) [orb1650600]
>95% as determined by SDS-PAGE and HPLC.
41.0 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human NGAL protein (Active) (orb359266)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review