You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 28-357aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 36.2 kDa |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | M+QVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−NovH, Insulin-like growth factor-binding protein 9, IBP-9, IGF-binding protein 9, IGFBP-9
Similar Products
−Recombinant human CTGF protein (Active, CHO) [orb3124200]
≥ 95% as determined by SDS-PAGE.
35.5 kDa
10 μg, 50 μg, 500 μgRecombinant Human Protein NOV homolog protein(NOV) (Active) [orb1650598]
>95% as determined by SDS-PAGE and HPLC.
36.2 kDa
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human NOV protein (Active)
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human NOV protein (Active) (orb359188)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review