You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 19-170aa |
| Protein Length | Full Length of Mature Protein of Isoform 3 |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 17.3 kDa |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PLGF Rabbit Polyclonal Antibody [orb381953]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μlRecombinant human PLGF-2 protein, His (HEK293) [orb1516685]
>95% as determined by SDS-PAGE
26-30 kDa
100 μg, 500 μg, 20 μgHuman PLGF(Placenta Growth Factor) Microsample ELISA Kit [orb2999089]
Human
31.25-2000 pg/mL
7.8 pg/mL
96 T, 48 TRecombinant Human PLGF-2 Protein [orb3002401]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.2 KDa. Observed: 25-30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WB analysis of orb419319.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human PLGF protein (orb419319)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





