You have no items in your shopping cart.
Human SARS coronavirus Spike glycoprotein(S) protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus (SARS-CoV) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 30 kDa |
| Expression Region | 306-527aa |
| Protein Length | Partial |
| Protein Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Novel Coronavirus Spike Glycoprotein RBD (SARS-CoV-2 S RBD) IgM Antibody ELISA Kit [orb692154]
Human
Request Information
Request Information
24 T, 48 T, 10 x 96 T, 5 x 96 T, 96 TSARS MERS Protein [orb753191]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
1 mg, 2 μg, 10 μgSARS MERS RBD Protein [orb753194]
Greater than 90.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
1 mg, 10 μg, 2 μgSARS MERS, Sf9 Active [orb1994941]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
100 μg, 10 μg, 2 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human SARS coronavirus Spike glycoprotein(S) protein (orb668866)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

