You have no items in your shopping cart.
Human TGF beta 1 protein
SKU: orb594740
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 4-40 pg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 12.8 kDa |
| Expression Region | 279-390aa |
| Protein Length | Partial |
| Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 50mM Glycine-HCl, 150mMNacl, pH 2.5 |
| Disclaimer | For research use only |
Alternative Names
−Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
Similar Products
−- Item 1 of 4
- Item 1 of 1
Human Cluster of Differentiation 109 (CD109) ELISA Kit [orb778185]
Human
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 T - Item 1 of 1
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit [orb775691]
Human
0.32-20 ng/mL
0.119 ng/mL
48 T, 96 T - Item 1 of 1
Human Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit [orb1291338]
Human
0.16-10 ng/mL
0.054 ng/mL
96 T, 48 T - Item 1 of 5
Claudin 1/CLDN1 Rabbit Polyclonal Antibody [orb669070]
ICC, IF, IHC
Human
Rabbit
Polyclonal
Unconjugated
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TGF beta 1 protein (orb594740)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks